Technical Data
125051
CLDN4 (Claudin-4, Claudin 4, Clostridium Perfringens Enterotoxin Receptor, CPE-R, CPE-receptor, Williams-Beuren Syndrome Chromosomal Region 8 Protein, CPER, CPETR1, WBSCR8)
Description:
Claudin 1-8 proteins are a family of transmembrane proteins associated with tight junctions. Tight junctions are specialized regions of cell to cell contact; made up of network of strands to act as a molecular gasket for preventing the leakage of ions, water etc. between cells. They are abundant in luminal epithelial sheets where they maintain epithelial cell polarity. Different tissues exhibit different Claudin composition.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG3,k4A4Affinity Purified
SizeStorageShippingSourceHost
100ug4C Do Not FreezeBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa29-78 from human CLDN4 (NP_001296) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human CLDN4.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.