Technical Data
125090
CLPP (Putative ATP-dependent Clp Protease Proteolytic Subunit, Mitochondrial, Endopeptidase Clp)
Description:
Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. Clp may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates.

Applications:
Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST*

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2b,k3E2Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
Not determined
Immunogen:
Partial recombinant corresponding to aa178-278 from CLPP (NP_006003) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human CLPP. Species Crossreactivity: rat.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.