Technical Data
125099
CLTB (Clathrin Light Chain B, Lcb)
Description:
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
PabIgGAffinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanRabbit
Concentration:
As reported
Immunogen:
Full length human CLTB, aa1-211 (NP_001825.1).
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human CLTB. Species Crossreactivity: mouse.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.