Technical Data
125495
CXCL1 (Growth-regulated alpha Protein, C-X-C Motif Chemokine 1, GRO-alpha(1-73), Melanoma Growth Stimulatory Activity, MGSA, Neutrophil-activating Protein 3, NAP-3, GRO, GRO1, GROA, SCYB1)
Description:
GRO Alpha (CXCL1), a small cytokine belonging to the CXC chemokine family, secreted by human melanoma cells, has mitogenic properties and is implicated in melanoma pathogenesis. GRO alpha is expressed by macrophages, neutrophils and epithelial cells, and has neutrophil chemoattractant activity. GRO Alpha plays a role in spinal cord development by inhibiting the migration of oligodendrocyte precursors and is involved in the processes of angiogenesis, inflammation, wound healing, and tumorigenesis. This chemokine elicits its effects by signaling through the chemokine receptor CXCR2. An initial study in mice showed evidence that GRO alpha decreased the severity of multiple sclerosis and may offer a neuro-protective function.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
PabIgGAffinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanRabbit
Concentration:
As reported
Immunogen:
Full length human CXCL1, aa1-107 (NP_001502.1).
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human CXCL1.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.