Technical Data
125699
DDAH2 (Dimethylarginine Dimethylaminohydrolase II, NG30, G6a, OTTHUMP00000174406, OTTHUMP00000029307, DADB-110M10.5, OTTHUMP00000062666, NG-dimethylarginine Dimethylamino Hydrolase Homolog, Dimethylarginine Dimethylaminohydrolase II, DDAHII, NG30, G6a, DD
Description:
DDAH2 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Overexpression of DDAH2 has also been linked to increased VEGF mRNA expression and enhanced tube formation by cells grown in a 3-dimensional medium.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLRLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDV

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2b,k3E3Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Full-length recombinant corresponding to aa1-286 from DDAH2 (AAH01435) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human DDAH2.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.