Technical Data
125720
DDT (D-dopachrome Decarboxylase, D-dopachrome Tautomerase, Phenylpyruvate Tautomerase II)
Description:
Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody.
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2b,k1G1Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Full length recombinant corresponding to aa1-118 from human DDT (AAH05971) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human DDT.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
1.D-dopachrome tautomerase is a candidate for key proteins to protect the rat liver damaged by carbon tetrachloride. Hiyoshi M, Konishi H, Uemura H, Matsuzaki H, Tsukamoto H, Sugimoto R, Takeda H, Dakeshita S, Kitayama A, Takami H, Sawachika F, Kido H, Arisawa K.Toxicology. 2009 Jan 8;255(1-2):6-14. Epub 2008 Sep 27.