Technical Data
125997
DPH2 (Diphthamide Biosynthesis Protein 2, DPH2 Homolog, HsDph2, Diphthamide Biosynthesis Protein 2 Homolog-like 2, DPH2-like 2, DPH2L2)
Description:
Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2.

Applications:
Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
RQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLS

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2a,k5B10Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa125-235 from human DPH2 (NP_001375) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human DPH2. Species Crossreactivity: rat.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.