Technical Data
126392
EPHB6 (Ephrin Type-A Receptor 6, Tyrosine-protein Kinase Receptor EPH-6, HEP)
Description:
EPHB6 belongs to the ephrin receptor kinase family. EPHB6 does not have intrinsic tyrosine kinase activity because six invariant amino acids were have been substituted. Despite its lack of kinase activity, ligand binding results in trans-phosphorylation of EphB6 and the initiation of specific cytoplasmic signaling events.

Applications:
Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2a,k5D8Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa23-122 from EPHB6 (NP_004436) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human EPHB6. Species Crossreactivity: mouse and rat.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.