Technical Data
126828
FKBP14 (FK506-binding Protein 14, Peptidyl-prolyl Cis-trans Isomerase FKBP14, PPIase FKBP14, Rotamase, 22kD FK506-binding Protein, 22kD FKBP, FKBP-2, FKBP-22, FLJ20731, FKBP22, FKBP-14, UNQ322/PRO381)
Description:
FKBP14, also known as 22kD FK506-binding protein, is an enzyme that accelerates the folding of proteins during protein synthesis. This protein contains two EF-hand domains and one PPIase FKBP-type domain. Truncation of the amino-terminus of FKBP14 greatly reduces peptidyl prolyl cis-trans isomerase activity, therefore suggesting that the PPIase FKBP-type domain must be located at the N-terminus.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
PabIgGAffinity Purified
SizeStorageShippingSourceHost
50ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Full length human FKBP14, aa1-211 (NP_060416.1).
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human FKBP14.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.