Technical Data
127615
GSTT1 (Glutathione S-transferase theta-1, GST Class-theta-1, Glutathione Transferase T1-1)
Description:
Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis. The GSTT1 gene is located approximately 50kb away from the GSTT2 gene. The GSTT1 and GSTT2 genes have a similar structure, being composed of five exons with identical exon/intron boundaries.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG1,k2E10-1B2Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Full length recombinant protein (240aa) corresponding to human GSTT1 (AAH07065) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human GSTT1.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
1. The prognostic and predictive power of redox protein expression for anthracycline-based chemotherapy response in locally advanced breast cancer. Woolston CM, et al. Mod Pathol. 2012 Apr 6. doi: 10.1038/modpathol.2012.60. [Epub ahead of print] 2. Redox Protein Expression Predicts Radiotherapeutic Response in Early-Stage Invasive Breast Cancer Patients. Woolston CM, et al. Int J Radiat Oncol Biol Phys. 2011 Feb 5. [Epub ahead of print] 3. Effects of Azithromycin (AZM) on Glutathione-S-Transferases (GST)s in Cystic Fibrosis Airway Cells. Bergamini G, et al. Am J Respir Cell Mol Biol. 2009 Aug;41(2):199-206. Epub 2008 Dec 18. 4. Anti-glutathione S-transferase T1 antibody-mediated rejection in C4d-positive renal allograft recipients. Aguilera I, et al. Nephrol Dial Transplant. 2008 Jul;23(7):2393-8. Epub 2008 Feb 28.