Technical Data
128065
HRASLS3 (PLA2G16, HRASLS3, HREV107, Group XVI Phospholipase A1/A2, Adipose-specific Phospholipase A2, H-rev 107 Protein Homolog, HRAS-like Suppressor 1, HRAS-like Suppressor 3, HREV107-1, HREV107-3, Renal Carcinoma Antigen NY-REN-65, MGC118754)
Description:
PLA2G16 specifically catalyzes the release of fatty acids from phospholipids in adipose tissue. It also has a weak lysophospholipase activity. Tumor suppressor that may be involved in interferon-dependent cell death.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ*

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG1,k1B10-2D9Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Full length recombinant corresponding to aa1-163 from HRASLS3 (AAH01387) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human HRASLS3.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.