Technical Data
128259
IFITM3 (Interferon-induced Transmembrane Protein 3, Dispanin Subfamily A Member 2b, DSPA2b, Interferon-inducible Protein 1-8U)
Description:
FITM3 is a 14.6kD (predicted) member of the CD225 family of proteins. It is expressed on primordial germ cells and select tumor types, and appears to regulate cell migration. Human IFITM3 is a 133aa, two-transmembrene protein that contains an N-terminal aa1-57 and a C-terminal aa108-128 extracellular domain. Over aa3-57, human IFITM3 is 59% and 56% aa identical to bovine and mouse IFITM3, respectively. Over aa3-57 human IFITM3 is 88% identical to human IFITM2.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MSHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGGPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
PabIgGAffinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanRabbit
Concentration:
As reported
Immunogen:
Full-length human IFITM3, aa1-133 (NP_066362.1).
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human IFITM3.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.