Technical Data
128886
KLK3 (APS, Prostate-specific Antigen, PSA, Gamma-seminoprotein, Seminin, Kallikrein-3, P-30 Antigen, Semenogelase)
Description:
Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. KLK 3 (also known as prostate speci c antigen) is a marker for prostatic cancer and is involved in the pathogenesis and/or progression of prostate, breast, and possibly other malignancies.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
PabIgGAffinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanRabbit
Concentration:
As reported
Immunogen:
Full length human KLK3, aa1-261 (NP_001639.1).
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human KLK3.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.