Technical Data
129015
LAT (Linker for Activation of T-cells Family Member 1, 36 kDa Phospho-tyrosine Adapter Protein, pp36, p36-38)
Description:
LAT is a transmembrane molecule that mediates signaling following the engagement of a number of cell surface receptors including TCR during mature T cell activation, pre-TCR during T cell development, Fc RIII on NK cells, and FceRI on mast cells. LAT is multiply phosphorylated on tyrosines by ZAP-70 and Syk, which leads to downstream effects that include release of intracellular calcium, PKC activation, MAPK activation and cytoskeletal reorganization. Palmitoylation of LAT is required for its localization to lipid rafts and efficient phosphorylation.

Applications:
Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGPHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN*

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG1,k3B11-1D5Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Full length recombinant corresponding to aa1-234 from human LAT (AAH11563) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human LAT.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.