Technical Data
129202
LRIT3 (Leucine-rich Repeat, Immunoglobulin-like Domain and Transmembrane Domain-containing Protein 3, FIGLER4, FLJ44691, MGC120618)
Description:
Might facilitate FGFR1 exit from the endoplasmic reticulum to the Golgi.

Applications:
Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody.
Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC*

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2a,k3E7Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant protein corresponding to aa422-497 from human LRIT3 (NP_940908) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human LRIT3.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.