Technical Data
130003
MUC5B (Mucin-5B, MUC-5B, Cervical Mucin, High Molecular Weight Salivary Mucin MG1, Mucin-5 Subtype B, Tracheobronchial, Sublingual Gland Mucin, MUC5)
Description:
Gel-forming mucin that is thought to contribute to the lubricating and viscoelastic properties of whole saliva and cervical mucus.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV*

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2a,k8C11Ascites
SizeStorageShippingSourceHost
200ul-20CBlue IceHumanMouse
Concentration:
Not determined
Immunogen:
Partial recombinant protein corresponding to aa4186-4296 from human MUC5B with GST tag. MW of the GST tag alone is 26kD.
Purity:
Ascites
Form
Supplied as a liquid in ascites fluid.
Specificity:
Recognizes human MUC5B.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.