Technical Data
131157
PER3 (Period Circadian Protein Homolog 3, hPER3, Cell Growth-inhibiting Gene 13 Protein, Circadian Clock Protein PERIOD 3, GIG13)
Description:
Component of the circadian clock mechanism which is essential for generating circadian rhythms. Can bind heme.

Applications:
Suitable for use in ELISA, Immunoprecipitation and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
WRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDSC

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2a,k3A7Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
Not determined
Immunogen:
Partial recombinant corresponding to aa1105-1201 from PER3 (NP_058515) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human PER3.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.