Technical Data
131163
PEX10 (Peroxisome Biogenesis Factor 10, Peroxin-10, Peroxisomal Biogenesis Factor 10, Peroxisome Assembly Protein 10, RING Finger Protein 69, RNF69, MGC1998)
Description:
Somewhat implicated in the biogenesis of peroxisomes.

Applications:
Suitable for use in Immunoprecipitation. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGITYQALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLYGFRQRQRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
PabIgGSerum
SizeStorageShippingSourceHost
100ul-20CBlue IceHumanRabbit
Concentration:
Not determined
Immunogen:
Full length human PEX10, aa1-346 (NP_722540.1).
Purity:
Serum
Form
Supplied as a liquid.
Specificity:
Recognizes human PEX10.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.