Technical Data
132799
RPP14 (Ribonuclease P Protein Subunit p14, P14)
Description:
Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2a,k3H4Ascites
SizeStorageShippingSourceHost
200ul-20CBlue IceHumanMouse
Concentration:
Not determined
Immunogen:
Partial recombinant corresponding to aa1-76 from human RPP14 (NP_008973) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Ascites
Form
Supplied as a liquid in ascites fluid.
Specificity:
Recognizes human RPP14.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.