Technical Data
132825
RPS6KB1 (STK14A, Ribosomal Protein S6 Kinase beta-1, 70kD Ribosomal Protein S6 Kinase 1, Ribosomal Protein S6 Kinase I, Serine/Threonine-protein Kinase 14A, p70 Ribosomal S6 Kinase alpha)
Description:
RPS6KB1 encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this rotein and overexpression of this kinase are seen in some breast cancer cell lines.

Applications:
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 0.5ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2b,k1E12Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa416-526 from human RPS6KB1 (NP_003152) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human RPS6KB1.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.