Technical Data
133521
SNX20 (Sorting Nexin-20, Selectin Ligand-interactor Cytoplasmic 1, SLIC1)
Description:
Applications:
Suitable for use in ELISA. Other applications not tested.

Recommended Dilution:
ELISA: 0.1ng/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
SGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVMGKSRPGEMTYPGSRGETGTAPEPDPRCPRQSDM

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2a,k4E9Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa47-129 from human SLIC1 (NP_699168) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human SLIC1.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.