Technical Data
A0855-93H
Activin B (Activin beta, Activin beta C Chain, Inhibin beta C Chain, IHBC, INHBC)
Description:
Applications:
Suitable for use in ELISA, Immunohistochemistry (paraffin), and Western Blot. Other applications not tested.

Recommended Dilution:
Western Blot: 1:5,000
Optimal dilutions to be determined by the researcher.

Storage and Stability:
May be stored at 4C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot and store at -20C. Aliquots are stable for at least 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
TypeIsotypeCloneGrade
MabIgG110B48Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
~0.5mg/ml
Immunogen:
Synthetic peptide, VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC, corresponding to aa82-113 of mature human activin BetaC-subunit.
Purity:
Purified by Protein G affinity chromatography.
Form
Supplied as a liquid in PBS, 0.09% sodium azide.
Specificity:
Recognizes human Activin B. Species Crossreactivity: rat.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.