Technical Data
A1059-62J
AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)
Description:
AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.

Applications
Suitable for use in Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Frozen): 1:1000- :2000
Optimal dilution determined by the researcher.

Positive Control:
Sheep brain (hypothalamus). No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP.

Storage and Stability:
Lyophilized powder may be stored at -20C for short-term only. Reconstitute with sterile 40-50% glycerol, PBS. Aliquot and store at -20C. Reconstituted product is stable for 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
TypeIsotypeCloneGrade
PabIgGSerum
SizeStorageShippingSourceHost
50ul4C (-20C Glycerol)Blue IceGuinea pig
Concentration:
~1mg/ml
Immunogen:
Synthetic peptide corresponding to aa 82-131, SPRRCVRLHESCLG QQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT a region within the carboxy domain of mouse agouti related protein.
Purity:
Serum
Form
Supplied as a lyophilized powder. Reconstitute with 50ul sterile 40-50% glycerol, PBS.
Specificity:
Recognizes AGRP. Species crossreactivity: sheep.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
Grayson BE, Allen SE, Billes SK, Williams SM, Smith MS, Grove KL (2006). Prenatal development of hypothalamic neuropeptide systems in the nonhuman primate. Neurosci 143 pp. 975-986.