Technical Data
Atrial Natriuretic Peptide, pro-, aa1-30 (ANP, ANF, Atrial natriuretic factor, Atrial natriuretic factor precursor, CDD ANF, Natriuretic Peptide Precursor A, NPPA, PND, Prepronatriodilatin, Cardiodilatin-related peptide)
Suitable for use in ELISA, RIA. Other applications not tested.

Recommended Dilution:
RIA: 1:5000
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized powder may be stored at -20C. Stable for 12 months at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. Reconstituted product is stable for 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
20ul-20CBlue IceHumanSheep
Synthetic human pro-ANP (aa 1-30) polylysine conjugated (NPMYNAVSNADLMDFKNLLDHLEEKMPLED)
Supplied as a lyophilized powder. Reconstitute with sterile dH2O.
Recognizes synthetic human pro-Atrial Natriuretic Peptide (aa 1-30). There were no cross reactivities obtained with human pro-ANP.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
Hartter E, Khalafpour S, Missbichler A, Hawa G, Woloszczuk W. Enzyme immunoassays for fragments (epitopes) of human proatrial natriuretic peptides. Clin Chem Lab Med 2000;38:27-32.