Technical Data
B0899-03G
BD1, aa1-36 (beta Defensin-1)
Description:
Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Western Blotting: 1:1000-1:2000
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized powder may be stored at -20C. Reconstitute with sterile buffer or ddH2O. Aliquot and store at -20C. Reconstituted product is stable for 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
TypeIsotypeCloneGrade
MabIgG1M4-14b-H4 Affinity Purified
SizeStorageShippingSourceHost
10ug-20CBlue IceHumanMouse
Concentration:
~1mg/ml
Immunogen:
Synthetic human -Defensin 1 (aa 1-36) (3 disulfide bridges) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK)
Purity:
Purified from cell culture supernatant by Protein G affinity chromatography
Form
Supplied as a lyophilized powder in 50mM Tris, pH 7.4.
Specificity:
Recognizes human -Defensin 1 (epitope: aa 1-36)
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.