		Technical Data
B0899-04A	BD1, aa1-36, Control Peptide (beta Defensin-1)	100ug

Growth Factors, Cytokines

Storage: -20°CShipping: RT

Control Peptide for B0899-04, BD1, aa1-36 (beta Defensin-1).

Source:
Synthetic peptide corresponding to aa1-36, DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK, beta-Defensin 1 peptide.

Applications:
Suitable for use in ELISA and Antibody Blocking. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized powder may be stored at -20°C. Reconstitute with 0.1% acetic acid for required concentration. Aliquot and store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Source: Synthetic
Purity: ~95% (HPLC)
Form: Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.