Technical Data
B0901-01B
BD2, aa4-41 (beta Defensin-2)
Description:
Applications:
Suitable for use in ELISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized powder may be stored at -20C. Reconstitute with sterile buffer or ddH2O. Aliquot and store at -20C. Reconstituted product is stable for 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
TypeIsotypeCloneGrade
MabIgG1L12-4C-C2 Affinity Purified
SizeStorageShippingSourceHost
10ug-20CBlue IceHumanMouse
Concentration:
~1mg/ml
Immunogen:
Synthetic human -Defensin 2 (aa 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Purity:
Purified from cell culture supernatant by Protein G affinity chromatography
Form
Supplied as a lyophilized powder in 50mM Tris, pH 7.4.
Specificity:
Recognizes human beta-Defensin 2 (epitope: aa 4-41)
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.