![]() |
Technical Data |
|
B1081-40J |
BTC, Recombinant, Human (Probetacellulin, Betacellulin) |
20ug |
| Growth Factors, Cytokines | Storage: -20°CShipping: Blue Ice |
|
Human Betacellulin (BTC) is a potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. The effects of betacellulin are probably mediated by the egf receptor and other related receptors. Human Recombinant BTC produced in E.coli is a single, non- glycosylated, polypeptide chain containing 80aa and having a molecular mass of 9kD. BTC was purified by proprietary chromatographic techniques. Source: Recombinant corresponding to human BTC expressed in E. coli. AA Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVA EQTPSCVCDEGYIGARCERVDLFY Molecular Weight: ~9kD Biological Activity: The ED50, calculated by the dose-dependent proliferation of murine BALBC 3T3 cells (measured by 3H-thymidine uptake) is <0.05ng/ml. Specific Activity: >2×10e7IU/mg. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Molecular Weight: ~9kD |
Source: E. coli Purity: ~97% (SDS-PAGE, HPLC) Concentration: Not determined Form: Supplied as a lyophilized powder from 20mM phosphate buffer, pH 7.4. Reconstitute with sterile ddH2O to 100ug/ml. Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
|
|
||