Technical Data
B2702-30
Brain Natriuretic Peptide, Recombinant, Human (BNP)
2ug
10ug
Molecular Biology Storage: -20°CShipping: RT
Brain Natriuretic Protein is a protein secreted by the brain and the heart atria, stored mainly in cardiac ventricular myocardium. It can cause Natriuresis; Diuresis; Vasodilation; and inhibits secretion of Renin and Aldosterone. It improves heart function. BNP contains 32 Amino acids.

Amino acid sequence:
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Storage and Stability:
Lyophilized powder may be stored at -20°C. Reconstitute to nominal volume by adding sterile, dH2O, 0.1% HSA or BSA. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Source: E. coli.
Purity: 98% by RP-HPLC, SDS-PAGE.
Form: Supplied as a lyophilized powder in PBS. Reconstitute with sterile, dH2O, 0.1% HSA or BSA to a concentration of 0.1mg/ml.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
1. Vanderheyden M, Goethals M, De Bruyne B, J Am Coll Cardiol 2004 Dec 21; 44(12): 2349-54. 2. Sutovsky I, Katoh T, Honma H, Jpn Heart J 2004 Sep;45(5):771-7. 3. Beck-da-Silva L, de Bold A, Williams K, Can J Cardiol 2004 Oct;20(12):1245-8. 4. Tsutamoto T, Horie M, Rinsho Byori 2004 Aug;52(8):655-68. 5. Hildebrandt P, Cardiovasc Drugs Ther 2004 May;18(3):181-2. 6. Saijo M, Takemura G, Okada H, Tsuchiya K, Intern Med 2004 Aug;43(8):700-3.

Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.