Technical Data
C0115-08G
Calcitonin (Alpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1, CGRP, CT, Katacalcin, KC, MGC126648)
Description:
Applications:
Suitable for use in RIA. Other applications not tested.

Recommended Dilutions:
RIA: 1:15,000
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized powder may be stored at -20C. Stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. Reconstituted product is stable for 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
TypeIsotypeCloneGrade
PabIgGSerum
SizeStorageShippingSourceHost
20ul-20CBlue IceHumanRabbit
Concentration:
Not Determined
Immunogen:
Synthetic peptide corresponding to CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP from human Calcitonin, conjugated to BSA
Purity:
Serum
Form
Supplied as a lyophilized powder. Reconstitute with 20ul sterile ddH2O.
Specificity:
Recognizes human Calcitonin. Does not crossreact with human Katacalcin or human Calcitonin gene-related peptide.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.