Technical Data
C0115-08G
Calcitonin (Alpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1, CGRP, CT, Katacalcin, KC, MGC126648)
Description:
Applications:
Suitable for use in RIA. Other applications not tested.

Recommended Dilution:
RIA: 1:15,000
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized powder may be stored at 4C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20C. Reconstituted product is stable for 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
TypeIsotypeCloneGrade
PabSerum
SizeStorageShippingSourceHost
20ul-20CBlue IceHumanRabbit
Concentration:
~1mg/ml
Immunogen:
Synthetic human Calcitonin, BSA-conjugated (CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP)
Purity:
Serum
Form
Supplied as a lyophilized powder in PBS, pH 7.2. Reconstitute in ddH2O.
Specificity:
Recognizes Human Calcitonin. There were no cross reactivities obtained with human Katacalcin and human Calcitonin Gene related Peptide.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.