Technical Data
C1385-10
Cardiotrophin 1 (CT-1)
Description:
Cardiotrophin-1 (CT-1) is a 201-amino-acid member of the interleukin-6 superfamily. It was identified by its ability to induce hypertrophic response in cardiac myocytes. CT-1 activates gp130 dependent signaling and stimulates the Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway to transduce hypertrophic and cytoprotective signals in cardiac myocytes. It has also a neurotrophic function. The deficiency causes increased motoneuron cell death in spinal cord and brainstem nuclei of mice during a period between embryonic day 14 and the first postnatal week. Moreover, CT-1 is a hepatocyte survival factor that efficiently reduces hepatocellular damage in animal models of acute liver injury.

CT-1 expression is augmented after hypoxic stimulation. It can protect cardiac cells when added either prior to simulated ischaemia or at the time of reoxygenation following simulated ischaemia. It can also induce expression of the protective heat shock proteins (hsps) in cardiac cells, increased ventricular expression of ANP, brain natriuretic peptide (BNP) and angiotensinogen mRNA. CT-1 levels were significantly elevated in patients with heart failure, dilatative cardiomyopathy, moderate/severe mitral regurgitation, stable and unstable angina and after acute myocardial infarction.

Sequence:

MRGSHHHHHHGS]SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Applications:
Suitable for use in ELISA, Western blotting.

Titer:
Defined by indirect ELISA is >1:100,000 for antibody concentration 1mg/ml, 25ng of antigen are coated per well, and is then defined at a point of maximal decrease of the titration curve.

Reconstitution:
Add 0.1ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Quality Control Test:
Indirect ELISA-to determine titer of the antibody.

Storage and Stability: May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot and add glycerol (40-50%). Freeze at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
TypeIsotypeCloneGrade
MabIgG15i143Affinity Purified
SizeStorageShippingSourceHost
100ug-20°CBlue IceHumanMouse
Concentration:
1mg/ml
Immunogen:
Human Cardiotrophin, created as a recombinant protein with N-terminal fusion of His-Tag, is a 22.5kD protein containing 200 amino acid residues of the human cardiotrophin and 12 additional amino acid residues from E. coli.
Purity:
Affinity chromatography on a column with immobilized protein G.
Form
Sterile filtered and lyophilized from 2mg/ml in 0.05 M PBS, 0.1M sodium chloride, pH 7.2.
Specificity:
The amino acid sequence of the recombinant human cardiotrophin is 100% homologous to the amino acid sequence of the human cardiotrophin.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
1. Freed DH, Moon MC, Borowiec AM, Jones SC, Zahradka P, Dixon IM. Cardiotrophin-1: expression in experimental myocardial infarction and potential role in post-MI wound healing. Mol Cell Biochem. 2003 Dec; 254(1-2): 247-56.
2. Freed DH, Borowiec AM, Angelovska T, Dixon IM. Induction of protein synthesis in cardiac
fibroblasts by cardiotrophin-1: integration of multiple signaling pathways. Cardiovasc Res. 2003 Nov 1; 60(2): 365-75.
3. Bristow MR, Long CS. Cardiotrophin-1 in heart failure. Circulation. 2002 Sep 17; 106(12): 1430-2.
4. Talwar S, Squire IB, O'brien RJ, Downie PF, Davies JE, Ng LL. Plasma cardiotrophin-1 following
acute myocardial infarction: relationship with left ventricular systolic dysfunction. Clin Sci (Lond).
2002 Jan; 102(1): 9-14.