![]() |
Technical Data |
|
C1385-11 |
Cardiotrophin 1 (CT-1) |
|
|
Description: Cardiotrophin-1 (CT-1) is a 201 amino acid member of the interleukin-6 superfamily. It was identified by its ability to induce hypertrophic response in cardiac myocytes. CT-1 activates gp130 dependent signaling and stimulates the Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway to transduce hypertrophic and cytoprotective signals in cardiac myocytes. It also has a neurotrophic function, has deficiency causes increased motoneuron cell death in spinal cord and brainstem nuclei of mice during a period between embryonic day 14 and the first postnatal week. Moreover, CT-1 is a hepatocyte survival factor that efficiently reduces hepatocellular damage in animal models of acute liver injury. CT-1 expression is augmented after hypoxic stimulation and it can protect cardiac cells when added either prior to simulated ischaemia or at the time of reoxygenation following simulated ischaemia. It can induce expression of the protective heat shock proteins (hsps) in cardiac cells, increased ventricular expression of ANP, brain natriuretic peptide (BNP) and angiotensinogen mRNA. CT-1 levels were significantly elevated in patients with heart failure, dilatative cardiomyopathy, moderate/severe mitral regurgitation, stable and unstable angina and after acute myocardial infarction. Amino acid sequence: MRGSHHHHHHGSSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA Applications: Suitable for use in ELISA, Western blotting. Titer: Defined by indirect ELISA is >1:100,000 for antibody concentration 1mg/ml, 25ng of antigen are coated per well, and is then defined at a point of maximal decrease of the titration curve. Reconstitution: Add 0.1ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation. Quality Control Test: Indirect ELISA-to determine titer of the antibody. Storage and Stability: May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot and add glycerol (40-50%). Freeze at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
|
|||||||||||
|
||||||||||||
|
||||||||||||
|
||||||||||||