Technical Data
C5073-01A
Ciliary Neurotropic Factor, Recombinant, Rat (CNTF)
20ug
Growth Factors, Cytokines Storage: -20°CShipping: Blue Ice
CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. CNTF is a survival factor for various neuronal cell types and seems to prevent the degeneration of motor axons after axotomy. CNTF Recombinant Rat produced in E. coli is a single, non-glycosylated polypeptide chain containing 200aa and having a molecular mass of 22834D. The CNTF is purified by proprietary chromatographic techniques.

Source:
Recombinant corresponding to rat CNTF expressed in E. coli.

AA Sequence:
AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEM- TEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDG-GLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM

Molecular Weight:
~22.834kD

Biological Activity:
Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.

Storage and Stability:
Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Molecular Weight:
~22.834kD
Source: E. coli
Purity: ~99% (SDS-PAGE)
Concentration: Not determined
Form: Supplied as a lyophilized powder from 0.025% sodium bicarbonate. Reconstitute in sterile dH2O or 0.4 % sodium bicarbonate adjusted to pH 8-9 to 100ug/ml.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.