Technical Data
C8297-99D
CXCL11, Recombinant, Human (Chemokine (C-X-C Motif) Ligand 11, b R1, H174, Interferon-inducible T Cell Alpha Chemoattractant, I-TAC, Interferon gamma Inducible Protein 9, IP-9, MGC102770, Small Inducible Cytokine B11, SCYB11, SCYB9B)
5ug
20ug
Growth Factors, Cytokines Storage: -70°CShipping: Dry Ice
CXCL11 cDNA encodes a 94 amino acid (aa) residue precursor protein with a 21 aa residue putative signal sequence, which is cleaved to form the mature 73 aa residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. CXCL11 is expressed at low levels in normal tissues including thymus, spleen and pancreas. The expression of CXCL11 mRNA is radically up regulated in IFN-y and IL-1 stimulated astrocytes. Moderate increase in expression is also observed in stimulated monocytes. CXCL11 has potent chemoattractant activity for IL-2 activated T cells and transfected cell lines expressing CXCR3, but not freshly isolated T-cells, neutrophils or monocytes.

Biological Activity:
Fully biologically active when compared to standard. Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng/ml.

AA Sequence:
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPK
SKQARLIIKKVERKNF

Endotoxin: 1EU/ug as determined by LAL method.

Storage and Stability:
Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months.

Molecular Weight:
8.3 kD
Source: Escherichia coli
Purity: ~97% by SDS-PAGE and HPLC analyses.
Concentration: 1mg/ml
Form: Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.