![]() |
Technical Data |
|
E3374-11U |
Epidermal Growth Factor, Recombinant, Rat (EGF, Pro-epidermal Growth Factor) |
20ug 100ug |
| Growth Factors, Cytokines | Storage: -20°CShipping: Blue Ice |
|
Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53aa peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 53aa and having a molecular mass of 6151D. The Rat EGF is purified by proprietary chromatographic techniques. Source: Recombinant corresponding to rat EGF expressed in E. coli. AA Sequence: NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR Molecular Weight: ~6.151kD Biological Activity: The ED50 as calculated by the dose-dependent proliferation of murine BALB/c 3T3 cells is less than 0.1ng/ml, corresponding to a specific activity of >1x10e7units/mg. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Molecular Weight: ~6.151kD |
Source: E. coli Purity: ~98% (SDS-PAGE, HPLC) Concentration: Not determined Form: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O to 100ug/ml. Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
|
|
||