		Technical Data
E3410	Epidermal Growth Factor, Recombinant, Human (E. coli) (EGF)	100ug 500ug 1mg

Growth Factors, Cytokines

Storage: -20°CShipping: RT

Epidermal Growth Factor (EGF) is a polypeptide growth factor which stimulates the proliferation of a wide range of epidermal and epithelial cells. Human EGF is a 6.2kD protein containing 53 amino acid residues.

AA Sequence:
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Biological Activity:
ED50 calculated by the dose-dependent proliferation of murine BALB/c 3T3 cells (measured by 3H-thymidine uptake) is <0.1ng/ml corresponding to a specific activity of 1x10e7units/mg.

Protein Content:
EGF quantitation was carried out by two independent methods:
1. UV spectroscopy at 280nm using the absorbency value of 2.858 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
2. Analysis by RP-HPLC, using a calibrated solution of EGF as a Reference Standard.

Storage and Stability:
Lyophilized powder may be stored at -20°C. Reconstitute with sterile ddH2O, 0.1% HSA or BSA. Aliquot and store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Molecular Weight:
6.2kD

Source: E. coli
Purity: 98% ([SDS-PAGE and HPLC)
Form: Supplied as a lyophillized powder. Reconstitute with sterile ddH2O, 0.1% HSA or BSA to 100ug/ml, which can then be further diluted to other aqueous solutions.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.