Technical Data
E3410
EGF, Recombinant, Human, Animal Free (Epidermal Growth Factor, Urogastrone, URG)
100ug
500ug
Molecular Biology Storage: -20CShipping: RT
Epidermal Growth Factor (EGF) is a polypeptide growth factor which stimulates the proliferation of a wide range of epidermal and epithelial cells. Human EGF is a 6.2kD protein containing 53 amino acid residues.

Amino Acid Sequence:
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Biological Activity:
Determined by its ability to stimulate the proliferation of murine BALB/c 3T3 cells.
The expected ED50 is 0.1ng/ml corresponding to a specific activity of 1x10e7units/mg.

Protein Content:
Verified by UV Spectroscopy an/or SDS-PAGE gel.

Storage and Stability:
Lyophilized powder may be stored at -20C. Stable for 6 months after receipt at -20C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20C. Reconstituted product is stable for 6 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Molecular Weight:
6.2kD
Source: E. coli
Purity: ~ 98% (SDS-PAGE and HPLC) Endotoxin: 0.1ng/ug (1EU/ug).
Form: Supplied as a lyophilized powder. No additives. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml. Add 0.1% HSA or BSA for long term storage. Do not vortex.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.