Technical Data
F4212-93J
Fibroblast Growth Factor 21, Recombinant, Mouse (FGF-21, Fgf21)
10ug
Growth Factors, Cytokines Storage: -20°CShipping: Blue Ice
The FGFs are a family of more than 20 small (~17–26kD) secreted peptides. The initial characterization of these proteins focused on their ability to stimulate fibroblast proliferation. FGFs modulate cellular activity via at least 5 distinct subfamilies of high-affinity FGF receptors (FGFRs): FGFR-1, -2, -3, and -4, all with intrinsic tyrosine kinase activity and, except for FGFR-4, multiple splice isoforms, and FGFR-5, which lacks an intracellular kinase domain. There is growing evidence that FGFRs can be important for regulation of glucose and lipid homeostasis. FGFR-2 appears to be a key molecule during pancreatic development and FGFR-4 has been implicated in cholesterol metabolism and bile acid synthesis. FGF-21 is preferentially expressed in liver, but an exact knowledge of FGF-21 bioactivity and its mode of action have been lacking to date. FGF-21 is a potent activator of glucose uptake on adipocytes, protects animals from diet-induced obesity when overexpressed in transgenic mice, and lowers blood glucose and triglyceride levels when therapeutically administered to diabetic rodents. Fibroblast Growth Factor-21 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 183aa including N-terminal Methionine and having a molecular mass of 20.1kD. The aa sequence of the recombinant mouse FGF21 is 100% homologous to the aa sequence of the mouse FGF21 without signal sequence. The FGF-21 is purified by proprietary chromatographic techniques.

Source:
Recombinant corresponding to mouse FGF-21 expressed in E. coli.

AA Sequence:
MAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPG VIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSP NQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Molecular Weight:
~20.1kD

Storage and Stability:
Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Molecular Weight:
~20.1kD
Source: E. coli
Purity: ~95% (SDS-PAGE, HPLC)
Concentration: Not determined
Form: Supplied as a lyophilized powder from 20mM Tris, pH 7.4, 20mM sodium chloride. Reconstitute with sterile dH2O to 100ug/ml.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.