Technical Data
G8975-86R
GRO9, Recombinant, Human (CXCL9, Chemokine (C-X-C motif) ligand 9, CMK, crg-10, C-X-C motif chemokine 9, Gamma-interferon-induced monokine, Humig, MIG, SCYB9, Small-inducible cytokine)
5ug
20ug
20ug
|
Technical Data |
|
G8975-86R |
GRO9, Recombinant, Human (CXCL9, Chemokine (C-X-C motif) ligand 9, CMK, crg-10, C-X-C motif chemokine 9, Gamma-interferon-induced monokine, Humig, MIG, SCYB9, Small-inducible cytokine) |
5ug 20ug |
| Growth Factors, Cytokines | Storage: -70°CShipping: Dry Ice |
|
CXCL9, a member of the subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system specifically in response to IFN- . CXCL9 has been shown to be a chemoattractant for activated T-lymphocytes and TIL but not for neutrophils or monocytes. The human CXCL9 cDNA encodes a 125 amino acid residue precursor protein with a 22 amino acid residue signal peptide that is cleaved to yield a 103 amino acid residue mature protein. CXCL9 has an extended carboxy-terminus containing greater than 50% basic amino acid residues and is larger than most other chemokines. A chemokine receptor (CXCR3) specific for CXCL9 and IP-10 has recently been cloned and shown to be highly expressed in IL-2-activated T-lymphocytes. Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10.0-100.0ng/ml. AA Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSA DVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT Endotoxin: 1EU/ug as determined by LAL method. Storage and Stability: Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months. Molecular Weight: 11.7 kD |
Source: Escherichia coli Purity: ~97% by SDS-PAGE and HPLC analyses. Concentration: 1mg/ml Form: Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
|
|
||