Technical Data
G8975-86S
GRO10, Recombinant, Human, (CXCL10, C-X-C Chemokine Ligand 10)
5ug
25ug
25ug
|
Technical Data |
|
G8975-86S |
GRO10, Recombinant, Human, (CXCL10, C-X-C Chemokine Ligand 10) |
5ug 25ug |
| Growth Factors, Cytokines | Storage: -70°CShipping: Dry Ice |
|
IP-10 was originally identified as an IFN- -inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1b, TNF-a, IL-12 and viruses. Additional cell types that have been shown to express IP-10 include activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells. IP-10 is also expressed in psoriatic and lepromatous lesions of skin. The mouse homologue of human IP-10, Crg-2, has been cloned andshown to share approximately 67% amino acid sequence identity with human IP-10. Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 10.0-100.0ng/ml. AA Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPES KAIKNLLKAVSKEMSKRSP Endotoxin: 1EU/ug as determined by LAL method. Storage and Stability: Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months. Molecular Weight: 8.5 kD |
Source: Escherichia coli Purity: ~97% by SDS-PAGE and HPLC analyses. Concentration: 1mg/ml Form: Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
|
|
||