Technical Data
G8975-86S
GRO10, Recombinant, Human, (CXCL10, C-X-C Chemokine Ligand 10)
5ug
25ug
Growth Factors, Cytokines Storage: -70°CShipping: Dry Ice
IP-10 was originally identified as an IFN- -inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1b, TNF-a, IL-12 and viruses. Additional cell types that have been shown to express IP-10 include activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells. IP-10 is also expressed in psoriatic and lepromatous lesions of skin. The mouse homologue of human IP-10, Crg-2, has been cloned andshown to share approximately 67% amino acid sequence identity with human IP-10.

Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 10.0-100.0ng/ml.

AA Sequence:
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPES
KAIKNLLKAVSKEMSKRSP

Endotoxin: 1EU/ug as determined by LAL method.

Storage and Stability:
Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months.

Molecular Weight:
8.5 kD
Source: Escherichia coli
Purity: ~97% by SDS-PAGE and HPLC analyses.
Concentration: 1mg/ml
Form: Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.