Technical Data
H7022-32
Hox 10 (Ceh 10 Homeodomain Containing Homolog (C. elegans), CHX10, Homeobox Protein CHX10, MCOP2, MCOPCB3, RET1, Vsx2)
Description:
Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Western Blot: 0.5-1ug/ml. Detects a band of approximately 46kD in mouse and rat retinal tissue lysates.
Optimal dilutions to be determined by the researcher.

Cellular Localization: Nuclear

Positive Control: Rat or mouse retinal tissue lysate.

Storage and Stability:
May be stored at 4C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot Store at -20C. Aliquots are stable for at least 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
TypeIsotypeCloneGrade
PabIgGPurified
SizeStorageShippingSourceHost
250ug-20CBlue IceHumanSheep
Concentration:
~1mg/ml
Immunogen:
Recombinant fragment: EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA, corresponding to C-terminal amino acids 264-361 of Human CHX10
Purity:
Purified
Form
Supplied as a liquid in PBS, containing 0.08% sodium azide.
Specificity:
Recognizes human HOX10. Species Crossreactivity: Mouse, rat and bovine.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
1. Chen CM & Cepko CL Expression of Chx10 and Chx10-1 in the developing chicken retina. Mech Dev 90:293-7 (2000). 2. Ferda Percin E et al. Human microphthalmia associated with mutations in the retinal homeobox gene CHX10. Nat Genet 25:397-401 (2000). 3. Liu IS et al. Developmental expression of a novel murine homeobox gene (Chx10): evidence for roles in determination of the neuroretina and inner nuclear layer. Neuron 13:377-93 (1994).