Technical Data
I7661-11D
Insulin-Like Growth Factor I, Recombinant, Human (IGF1, IGF I)
1mg
Growth Factors, Cytokines Storage: -20°CShipping: Blue Ice
Insulin Like Growth Factor-I (IGF-I) is a polypeptide growth factor which stimulates the proliferation of a wide range of cell types including muscle, bone, and cartilage tissue. Recombinant Human IGF-I is a single, nonglycosylated, 7.6kD protein containing 70 amino acid residues. Insulin-like growth factor 1 (IGF-I) is involved in regulation of neuronal growth and development in central and peripheral nervous system. It is known to protect neurons against cell death induced by amyloidogenic derivatives, glucose or serum
deprivation through pathways involving AKT kinase and transcription factor FKHRL1 phosphorylation. Activation of the insulin-like growth factor system has emerged as a key factor for tumor progression and resistance to apoptosis in many cancers like breast and thyroid cancers.

AA Sequence:
GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY CAPLKPAKSA

Biological Activity:
1-7ng/ml. Measured in cell proliferation assay with NIH3T3 cells

Storage and Stabiltiy:
Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Molecular Weight:
7.6kD
Source: Recombinant, Human (E. coli)
Purity: ~98% by SDS-PAGE and HPLC analyses. Endotoxin:
0.1ng/ug.
Form: Supplied as a lyophilized powder with no additives. Reconsitute in sterile ddH2O to a concentration of 0.1-1mg/ml. Also available as a liquid. See I7661-11C.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.