Technical Data
I8432-10
Interleukin 10, Recombinant, Mouse (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF)
2ug
10ug
Growth Factors, Cytokines Storage: -20°CShipping: RT
Interleukin-10 (IL-10), originally known as Cytokine Synthesis Inhibitory Factor (CSIF), is an 18.7kD protein that shares over 80% sequence homology with the Epstein-Barr Virus protein BCRFI. The reported biological activities of IL-10, which may be inter-related, include inhibition of macrophage mediated cytokine synthesis, suppression of the delayed type hyper-sensitivity response, and stimulation of the Th2 cell response which results in elevated antibody production.
Source: E. coli
Form: Supplied as a lyophilized powder in 10mM PBS, pH 7.0.
Purity: 98% by SDS-PAGE and HPLC analysis.
Endotoxin: 0.1 ng/ug
Reconstitution: Reconstitute in 3mM Tris, pH 8.0 to a concentration of 0.1-1mg/ml. This solution can then be diluted into other aqueous solutions.
Storage and Stability: Lyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding ddH2O, aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Biological Activity: Murine IL-10 is fully biologically active when compared to standards. The ED50 as determined by the dose-dependent co-stimulation (with IL-4) of the proliferation of murein MC-9 cells is 2ng/ml, corresponding to a specific activity of 5x10e5 units/mg.
Responding Cells (partial list):
T cells, macrophages
AA Sequence:
MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGY LGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS
Country of Origin:
USA

Molecular Weight:
18.7kD
Source: E coli

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.