Technical Data
M1202-73L
Macrophage Inflammatory Protein 3, Recombinant, Human (MIP3)
5ug
20ug
20ug
|
Technical Data |
|
M1202-73L |
Macrophage Inflammatory Protein 3, Recombinant, Human (MIP3) |
5ug 20ug |
| Growth Factors, Cytokines | Storage: -20°CShipping: Dry Ice |
|
MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors. Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 10.0 -50.0 ng/ml. AA Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPK QTWVKYIVRLLSKKVKNM Endotoxin: 1EU/ug as determined by LAL method. Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with distilled water, containing 0.1% BSA . Aliquot and store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Molecular Weight: 8.0 kD |
Source: Escherichia coli Purity: >97% by SDS-PAGE and HPLC analyses. Concentration: 1mg/ml Form: Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
|
|
||