Technical Data
M1202-73L
Macrophage Inflammatory Protein 3, Recombinant, Human (MIP3)
5ug
20ug
Growth Factors, Cytokines Storage: -20°CShipping: Dry Ice
MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.

Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 10.0 -50.0 ng/ml.

AA Sequence:
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPK
QTWVKYIVRLLSKKVKNM

Endotoxin: 1EU/ug as determined by LAL method.

Storage and Stability:
Lyophilized powder may be stored at -20°C. Reconstitute with distilled water, containing 0.1% BSA . Aliquot and store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Molecular Weight:
8.0 kD
Source: Escherichia coli
Purity: >97% by SDS-PAGE and HPLC analyses.
Concentration: 1mg/ml
Form: Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.