Technical Data
M1202-73M
Macrophage Inflammatory Protein 4, Recombinant, Human (MIP4)
2ug
10ug
10ug
|
Technical Data |
|
M1202-73M |
Macrophage Inflammatory Protein 4, Recombinant, Human (MIP4) |
2ug 10ug |
| Growth Factors, Cytokines | Storage: -20°C/-70°CShipping: Blue Ice |
|
CCL18, is a novel CC chemokine that is highly homologous to MIP-1a (61% amino acid sequence identity). CCL18 cDNA encodes an 89 aa residue precursor protein with a 20 aa putative signal peptide that is cleaved to generate a 69 aa residue mature protein which lacks potential glycosylation sites. In vitro, CCL18 mRNA expression is induced in alternatively activated macrophages by Th2 cytokines such as IL-4, IL-10 and IL-13, and inhibited by IFN-y. CCL18 mRNA is also expressed by GM-CSF/IL-4-induced monocyte-derived dendritic cells. In vivo, CCL18 is highly expressed in lung and placenta but is not expressed in epidermal Langerhans cells. Recombinant CCL18 has been shown to chemoattract naive T cells, but not monocytes or neutrophils. Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 1.0 -10.0 ng/ml. AA Sequence: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKK WVQKYISDLKLNA Endotoxin: 1EU/ug as determined by LAL method. Storage and Stability: Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months. Molecular Weight: 7.8 kD |
Source: Escherichia coli Purity: ~97% by SDS-PAGE and HPLC analyses. Concentration: 1mg/ml Form: Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
|
|
||