Technical Data
M2750-11D
MCP2, Recombinant, Human (Macrophage/Monocyte Chemotactic Protein 2, Chemokine C-C Motif Ligand 8, CCL8, HC14, Monocyte Chemotactic Protein 2, Small Inducible Cytokine A8 Precursor, SCYA8, SCYA10)
2ug
10ug
10ug
|
Technical Data |
|
M2750-11D |
MCP2, Recombinant, Human (Macrophage/Monocyte Chemotactic Protein 2, Chemokine C-C Motif Ligand 8, CCL8, HC14, Monocyte Chemotactic Protein 2, Small Inducible Cytokine A8 Precursor, SCYA8, SCYA10) |
2ug 10ug |
| Growth Factors, Cytokines | Storage: -70°CShipping: Dry Ice |
|
MCP-2 and MCP-3 are two recently identified monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the C-C family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1. MCP-3 also shares 58% amino acid identity with MCP-2. Similarly to other C-C chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes. All three cytokines have also been shown to attract eosinophils and induce histamine secretion from basophils. Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood monocytes using a concentration range of 10.0 -100.0 ng/ml. AA Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCAD PKERWVRDSMKHLDQIFQNLKP Endotoxin: 1EU/ug as determined by LAL method. Storage and Stability: Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months. Molecular Weight: 8.9 kD |
Source: Escherichia coli Purity: ~96% by SDS-PAGE and HPLC analyses. Concentration: 1mg/ml Form: Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
|
|
||