Technical Data
M4688-18B
MDR Protein (MRP1, Multidrug resistance-associated protein 1, ABCC1, ATP-binding cassette sub-family C member 1, Leukotriene C(4) transporter)
Description:
The MRP molecule, an integral membrane glycophosphoprotein belonging to the same superfamily of ATP-binding cassette transmembrane transporter proteins as P-glycoprotein, is overexpressed in many P-glycoprotein-negative, multidrug resistant cell lines and tumors. It is believed that the main function of MRP in drug resistance is that of a plasma membrane drug efflux pump.

Positive Control: 293 transfected lysate

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
May be stored at 4C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot Store at -20C. Aliquots are stable for at least 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
TypeIsotypeCloneGrade
MabIgG18L796Ascites
SizeStorageShippingSourceHost
100ul-20CBlue IceHumanMouse
Concentration:
~6.8mg/ml
Immunogen:
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. [Swiss-Prot# P33527]. Homology: 96% to rat, monkey, and cat proteins. 88% to chicken protein. 87% to bovine protein. 72% to Drosoph
Purity:
Ascites
Form
As reported
Specificity:
Species Crossreactivity: This antibody crossreacts with human and mouse protein. Other species have not been tested.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
1. Chen, Q, et al. JBC. 281: 31152-31163 (2006)