Technical Data
R2031-15B
Ribonucleotide Reductase (Ribonucleoside-Diphosphate Reductase Large Subunit, Ribonucleoside-Diphosphate Reductase Subunit M1, Ribonucleotide Reductase Large Subunit, RRM1, RR1)
Description:
RRM1 is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. Its gene is located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. Its gene may play a role in malignancies and disease that involve this region.

Applications:
Suitable for use in ELISA and Western Blot. Other applications have not been tested.

Recommended Dilutions:
Optimal dilutions to be determined by researcher.

Storage and Stability:
Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O or PBS. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
TypeIsotypeCloneGrade
PabIgGAffinity Purified
SizeStorageShippingSourceHost
100ug-20°CBlue IceHumanRabbit
Concentration:
~1mg/ml after reconstitution
Immunogen:
Synthetic peptide from near the N-terminal region of RRM1 (ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL)
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a lyophilized powder from PBS, pH 7.4. To reconstitute, add 100ul ddH2O.
Specificity:
Recognizes human RRM1. Species crossreactivity: mouse, rat, dog, C. elegans and zebrafish.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.