Technical Data
T8250-15A
Transforming Growth Factor beta1, Recombinant, Human, active (TGF beta 1, TGFb1, Camurati Engelmann Disease, CED, Diaphyseal Dysplasia 1 Progressive, DPD1, TGFb1, Differentiation Inhibiting Factor, Cartilage-inducing Factor)
1ug
5ug
Growth Factors, Cytokines Storage: -20°CShipping: Blue Ice
The three mammalian isoforms of TGF-beta, TGF-beta1, beta2, beta3, signal through the same receptor and elicit similar biological responses. They are multifunctional cytokines that regulate cell proliferation, growth, differentiation and motility as well as synthesis and deposition of the extracellular matrix. They are involved in various physiological processes including embryogenesis, tissue remodeling and would healing. They are secreted predominantly as latent complexes which are stored at the cell surface and in the extracellular matrix. The release of biologically active TGF-beta isoform from a latent complex involves proteolytic processing of the complex and /or induction of conformational changes by proteins such as thrombospondin-1. TGF-beta1 is the most abundant isoform secreted by almost every cell type. It was originally identified for its ability to induce phenotypic transformation of fibroblasts and recently it has been implicated in the formation of skin tumors. Human TGF-beta 1 is a 25kD protein with each subunit containing 112 amino acid residues, linked by a single disulfide bond.

Recombinant protein corresponding to human TGF-b1 expressed in CHO cells

Amino Acid Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYGRKPKVEQLSNMIVRSCKCS

Biological Activity:
The ED50 is determined by TGF-b1 ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells is 0.05ng/ml
Specific Activity: 2x10e7u/mg

Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with 10mM citric acid, pH 3.0. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in PBS, 0.1% BSA or HSA.

Country of Origin: USA

Molecular Weight:
25kD
Purity: 98% by SDS-PAGE and HPLC
Endotoxin: 0.1ng/ug (1EU/ug)
Form: Supplied as a lyophilized powder from 1mM sodium citrate, pH 3.5. Reconstitute in 10mM citric acid, pH 3.0 to a concentration of 0.1-1mg/ml Do not vortex.. It is recommended that further dilutions be made in PBS, 0.1% BSA or HSA.

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
US Biological application reference: 1. Smith, P.C. and Martinez, J. (2006) J. Dental Research 85:150-155. 2. Bajpai V.K. et al., (2012) Stem Cell Research, 8; 74-84. 3. Hough C, et al., (2012) PLoS ONE 7(8): e42513. doi:10.1371/journal.pone.0042513.

Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.