Technical Data
T8252-90
Transforming Growth Factor beta Induced, Recombinant, Human (BIGH3, TGFBI, ig-h3)
100ug
250ug
Growth Factors, Cytokines Storage: 4C/-20CShipping: Blue Ice
BIGH3, also known as TGFBI and ig-h3, is an extracellular matrix protein induced by transforming growth factor(TGF)-beta 1. BIGH3 protein is involved in cell growth, cell differentiation, wound healing and cell adhesion. In addition, some missense mutations of BIGH3 were identified in families affected with human autosomal dominant corneal dystrophies. BIGH3 gene encodes for a 683 amino-acid protein containing an RGD motif and four internal repeated domains which have highly conserved sequences founded in several species (Fasciclin domain). Recombinant human BIGH3 protein (fourth FAS domain) was expressed in E. coli and purified by using conventional chromatography techniques.

Molecular Weight:
14.5kD (135 amino acids, residues 502-636)

Sequence:
MGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVF
APTNEAFRALPPRERSRLLGDAKELANILKYHIGDEILV
SGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDI
MATNGVVHVITNVLQPPA

Storage and Stability:
May be stored at 4C for short-term only. For long-term storage, store at -20C. Aliquots are stable for at least 6 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Molecular Weight:
14.5 kD
Source: Human, Recombinant E. coli
Purity: 95% by SDS PAGE
Concentration: ~1mg/ml
Form: Supplied as a liquid in 20mM Tris-HCl, pH 8.0

Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
1. Billings PC, et al. (2002). J Biol Chem. 277. 2800328009 2. Munier FL. et al. (2002). Invest Ophthalmol Vis Sci. 43.949954. 3. Jung-Eun Kim, et al.(2000) J Biol Chem. 275. 3090730915

Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.