122864-ML650
Clone Type
MonoclonalHost
MouseSource
HumanConjugate
MaxLight™650Isotype
IgG1,kClone Number
2G2Grade
Affinity PurifiedApplications
FLISA IF IHC WBCrossreactivity
Hu Mo RtAccession #
NM_022735, NP_073572Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-ACBD3 (Golgi Resident Protein GCP60, Acyl-CoA-binding Domain-containing Protein 3, Golgi Complex-associated Protein 1, GOCAP1, Golgi Phosphoprotein 1, GOLPH1, PBR- and PKA-associated Protein 7, Peripheral Benzodiazepine Receptor-associated Protein PAP7, GCP60) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq]
Applications
Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa73-172 from human ACBD3 (NP_073572) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human ACBD3. Species Crossreactivity: mouse and rat.
